SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021701 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021701
Domain Number 1 Region: 62-144
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-27
Family FKBP immunophilin/proline isomerase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021701   Gene: ENSNLEG00000017862   Transcript: ENSNLET00000022794
Sequence length 198
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:63592528:63595940:1 gene:ENSNLEG00000017862 transcript:ENSNLET00000022794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVRRSRPSAPVYALDALS
PQGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRG
FPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRP
KVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences ENSNLEP00000021701 ENSNLEP00000021701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]