SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021792 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021792
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 70-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021792   Gene: ENSNLEG00000017940   Transcript: ENSNLET00000022892
Sequence length 345
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:50643130:50933691:1 gene:ENSNLEG00000017940 transcript:ENSNLET00000022892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD
EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHC
KNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSS
VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQ
YVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA
NSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPRDSEPSQGTEEV
Download sequence
Identical sequences A0A2K6CYQ8 G1S8F3 H2NDP5 H2Q3F1 Q86YD5
9598.ENSPTRP00000006091 9600.ENSPPYP00000003850 9606.ENSP00000318607 ENSNLEP00000021792 ENSPTRP00000006091 ENSNLEP00000021792 ENSP00000318607 gi|28557796|ref|NP_777562.1| ENSP00000318607 ENSPTRP00000006091 ENSP00000318607 ENSPPYP00000003850 ENSPPYP00000003850 NP_777562.1.87134 NP_777562.1.92137 XP_001142392.2.37143 XP_011722407.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]