SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021907 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021907
Domain Number 1 Region: 508-723
Classification Level Classification E-value
Superfamily GFP-like 1.05e-62
Family Domain G2 of nidogen-1 0.00076
Further Details:      
 
Domain Number 2 Region: 71-165
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 6-84
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 729-874
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-18
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 220-278
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.88e-16
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 6 Region: 277-335
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000118
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 7 Region: 165-221
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000183
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 8 Region: 449-506
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000419
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 9 Region: 925-1048
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000487
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 335-392
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000116
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 11 Region: 391-449
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000262
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 12 Region: 866-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000259
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021907   Gene: ENSNLEG00000018034   Transcript: ENSNLET00000023015
Sequence length 1156
Comment pep:novel supercontig:Nleu1.0:GL397296.1:6448440:6596322:1 gene:ENSNLEG00000018034 transcript:ENSNLET00000023015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLWNAILISQVKGDPTPTIQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVAT
NEAGVVERSMSLTLQSPPIITLEPVETVINAGGKIILNCQATGEPQPTITWSRQGHSISW
DDRVNVLSNNSLYIADAQKEDTSEFECVARNLMGSVLVRVPVIVQVHGGFSQWSAWRACS
VTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSPWEECTRSC
GRGNRTRTRTCSNPSAQHGGRPCEGNAAEIIMCNIRPCPVHGAWSAWQSWGTCSESCGKG
TQTRARLCNNPPPAFGGSSCDGAETQMQVCNERHCPIHGKWATWASWSACSVSCGGGARQ
RTRDCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYR
TCDNPRPSNGGRACGGPDSQIQRCNTDMCPVDGSWGSWHSWSRCSASCGGGEKTRKRLCD
HPAPVKGGRPCPGDTTQVTRCNVQACPGGPQRARGSVIGNINDVEFGIAFLNATITDSPN
SDTRIIRAKITNVPRSIGSAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVE
FATGEILQMSHIARGLDSDGALLLDIVVSGYVLQLQSPAEVTVKDYTEDYIQTGPGQLYA
YSTRLFTIDGISIPYTWNHTVFYDQAQGRMPFLVETLHASSVESDYNQIEETLGFKIHAS
ISKGDRSNQCPSGFTLDSVGPFCADEDECAAANPCSHTCHNAMGTYYCSCPKGLTIAADG
RTCQDIDECALGRHTCHAGQDCDNTIGSYRCVVRCGSGFQRTSDGLSCQDINECQESSPC
HQRCFNAIGSFHCGCEPGYQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGM
TKAENGTCIDIDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMDIDECENT
DACQHECKNTFGSYQCICPPGYQLTHNGKTCQDIDECLEQNVRCGANRMCFNMRGSYQCI
DTPCPPNYQRDPVSGFCLKNCPPNDLECALSPYALEYKLVSLPFGIATNQDLIRLVAYTQ
DGVMHPRTTFLMVDEEQIVPFALRDENLKGVVYTTRPLREAETYRMRVRASSYSANGTIE
YQTTFIVYIAVSAYPY
Download sequence
Identical sequences ENSNLEP00000021907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]