SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022034 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022034
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 2e-84
Family Integrin A (or I) domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.05e-22
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 3 Region: 353-468
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-22
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000167
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000022034
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022034   Gene: ENSNLEG00000018136   Transcript: ENSNLET00000023149
Sequence length 798
Comment pep:known_by_projection supercontig:Nleu1.0:GL397385.1:2108608:2164556:-1 gene:ENSNLEG00000018136 transcript:ENSNLET00000023149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWVGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences G1S945
XP_003276062.1.23891 XP_003276064.1.23891 ENSNLEP00000022034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]