SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022221 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022221
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.06e-21
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022221   Gene: ENSNLEG00000018317   Transcript: ENSNLET00000023342
Sequence length 50
Comment pep:novel supercontig:Nleu1.0:GL397330.1:7092125:7092277:-1 gene:ENSNLEG00000018317 transcript:ENSNLET00000023342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences ENSNLEP00000022221 ENSNLEP00000022221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]