SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022268 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022268
Domain Number 1 Region: 1-364
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-148
Family ALDH-like 0.0000000000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022268   Gene: ENSNLEG00000018370   Transcript: ENSNLET00000023395
Sequence length 369
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:19434443:19435549:-1 gene:ENSNLEG00000018370 transcript:ENSNLET00000023395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAGWADKWHGKTIPMDGPAFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVM
KVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGH
LIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVE
ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGG
ERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVIERANNTRYGLAAAV
FTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTV
TIKVPQKNS
Download sequence
Identical sequences ENSNLEP00000022268 ENSNLEP00000022268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]