SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022528 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022528
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.93e-103
Family Inorganic pyrophosphatase 0.000000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022528   Gene: ENSNLEG00000018649   Transcript: ENSNLET00000023674
Sequence length 289
Comment pep:known_by_projection supercontig:Nleu1.0:GL397354.1:5102915:5103784:1 gene:ENSNLEG00000018649 transcript:ENSNLET00000023674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSTEERAVPFSLEYQVFLKNEKGQYISPFHDIPIYADKDVFHVVVEVPRWSNAKMEI
ATKDPLNPIKQDVKERKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMVDEGETTWKVIAINVDDPDAANYNDINDVKQLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTREHWKALVTKKTNGKGI
SCMNTTVSESPLKCDPDAAGAIVDALPPPCESACTVPTDMDKWFHHQKN
Download sequence
Identical sequences ENSNLEP00000022528 ENSNLEP00000022528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]