SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023209 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023209
Domain Number 1 Region: 424-951
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.04e-154
Family alpha-mannosidase, C-terminal domain 0.00000124
Further Details:      
 
Domain Number 2 Region: 1-301
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.25e-114
Family alpha-mannosidase 0.0000000114
Further Details:      
 
Domain Number 3 Region: 304-418
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 6.54e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023209   Gene: ENSNLEG00000012209   Transcript: ENSNLET00000031997
Sequence length 952
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:8258500:8276615:1 gene:ENSNLEG00000012209 transcript:ENSNLET00000031997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKLQEDPRRRFLWAEVSFFAKWWDNINAQKRAAVRRLVGNGQLEIATGGWVMPDEANS
HYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAI
KKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGG
RINCPWKVPPRAITEANVAERAALLLDQYRKKSRLFRSNVLLVPLGDDFRYDKPQEWDAQ
FFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYAD
REDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDFTLLTE
ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDP
EAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVSLLVNSPRLRVLSE
EGQPLAVQISAHWSSATEAVPDVYQVSVPVRLPALGLGVLQLQLGLDGHRTLPSSVRVYL
HGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEQEQQVDMQ
VFVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVVAYYEHIHQAVRLY
NLPGVEGLSLDISSLVDIRDYVNKELALRIHTDIDSQGIFFTDLNGFQVQPRRYLKKLPL
QANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQLEVILDRRLMQDDNRGLGQGLKD
NKRTCNRFRLLLERRTVGSEVQDSHSTSYPSLLSHLTSTYLNTPVLALPVARTQLPGPGL
RSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNCTTSQ
GKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPMEIATFRLRLG
Download sequence
Identical sequences ENSNLEP00000023209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]