SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023282 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023282
Domain Number 1 Region: 18-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.11e-89
Family Eukaryotic proteases 0.0000000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023282   Gene: ENSNLEG00000026540   Transcript: ENSNLET00000032161
Sequence length 244
Comment pep:novel supercontig:Nleu1.0:GL397332.1:3082780:3107917:1 gene:ENSNLEG00000026540 transcript:ENSNLET00000032161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAFSLLISNPVAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLISEQWVVSAAH
CYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSWTLDNDILLIKLSSRAVINARV
STISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVLTQAECEASYPGKITSNM
FCVGFLEGGKDSCQGDSGGPVVSNGQLQGIVSWGYGCAQKNKPGVYTKVYNYVDWIKDTI
AANS
Download sequence
Identical sequences ENSNLEP00000023282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]