SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023994 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023994
Domain Number 1 Region: 462-752
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.32e-76
Family Protein kinases, catalytic subunit 0.000000289
Further Details:      
 
Domain Number 2 Region: 306-389
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 57-149
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-21
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023994
Domain Number - Region: 165-252
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00275
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023994   Gene: ENSNLEG00000015103   Transcript: ENSNLET00000032359
Sequence length 932
Comment pep:known_by_projection supercontig:Nleu1.0:GL397299.1:19743926:19924399:1 gene:ENSNLEG00000015103 transcript:ENSNLET00000032359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTAHKLLYLILSLSFSLPFFFFSETELSVSAELVPTSSWNISSELNKDSYLTLDEPMN
NITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTD
TGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNR
TVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPR
DLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPIAD
PINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNP
GNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIALLFFFI
CVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFG
KIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNVVCLLGAVTQE
QPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEY
LSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIM
YGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLM
TECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNLSNPR
YPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTGPPRVI
QHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSMPNHPGGMGITVFGNK
SQKPYKIDSKQASLLGDANIHGHTESMISAEL
Download sequence
Identical sequences M3ZBA7
ENSNLEP00000023994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]