SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024021 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024021
Domain Number 1 Region: 17-94
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-21
Family Kringle modules 0.0016
Further Details:      
 
Domain Number 2 Region: 179-285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-19
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024021   Gene: ENSNLEG00000009488   Transcript: ENSNLET00000032388
Sequence length 423
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:2890403:2894730:1 gene:ENSNLEG00000009488 transcript:ENSNLET00000032388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTTAATRTRTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPW
CYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMK
GYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSC
QGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPTGAALELTFRLFELADPRDRLELRDAAS
GSLLRAFDGARPPPPGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEVPQGS
AQTPAAPLDGANVSCSPRPGAPPAAMGARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAP
GKGPPALGPSRGPRRSWAVWYRQPRGVALPCSPGNPQAEGSAAGYRPLSASSQSSLRSLI
SAL
Download sequence
Identical sequences ENSNLEP00000024021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]