SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024035 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024035
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 4.71e-127
Family ALDH-like 0.000000000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024035   Gene: ENSNLEG00000010712   Transcript: ENSNLET00000032410
Sequence length 508
Comment pep:known_by_projection supercontig:Nleu1.0:GL397287.1:27335296:27360631:-1 gene:ENSNLEG00000010712 transcript:ENSNLET00000032410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVRRVRQAFLSSRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDSDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KKYQAVLRRKALLIFLVVHRLRWSSKQR
Download sequence
Identical sequences M3ZBE8
ENSNLEP00000013058 ENSNLEP00000024035 ENSNLEP00000013058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]