SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024356 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024356
Domain Number 1 Region: 15-92
Classification Level Classification E-value
Superfamily GTF2I-like repeat 2.22e-27
Family GTF2I-like repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024356   Gene: ENSNLEG00000026756   Transcript: ENSNLET00000032742
Sequence length 116
Comment pep:novel supercontig:Nleu1.0:GL397399.1:3255488:3259910:-1 gene:ENSNLEG00000026756 transcript:ENSNLET00000032742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RALPLTGDIIPHCDFLCPLGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTY
DIHRLEKILKAREHVRMVIINQLQPFAEICNDAKVPGESEVKKPPFCPVGTRDCSF
Download sequence
Identical sequences ENSNLEP00000024356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]