SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024365 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024365
Domain Number 1 Region: 776-1040
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-40
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 483-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000161
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 346-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000553
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 4 Region: 435-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000024365
Domain Number - Region: 705-755,1088-1117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000157
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 570-673
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00698
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024365   Gene: ENSNLEG00000026558   Transcript: ENSNLET00000032277
Sequence length 1123
Comment pep:novel supercontig:Nleu1.0:GL397519.1:293483:306366:1 gene:ENSNLEG00000026558 transcript:ENSNLET00000032277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGGPGGPGAEDVAVWARAQRLHVLARMARGPDTENMEEVGRWVAHQEKETRRLQRPGS
ARLFPLPGRDHKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFLEPYRSSAC
TSYSSCLGCLAYHGCGWCLTIATCHLRQGGAHCGDDGAGGSLLVLVPTLCPLCEEHRDCH
ACPQDPFCEWHQSTNRKGDAACSRRGRGRGALKSPEECPPLCSQRLTCEDCLANSSQCAW
CQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCDGFLTCHECLQSHECGWCGNED
NPTLGRCLQGDFSGPLGGGNCSLWVGEGWGFPWPSLPRWAYARCPDVDECRLGLARCHPR
ATCLNTPLSYECHCQRGYQGDGISHCNRTCLEDCGHGVCSGPPDFTCVCDLGWTSDLPPP
TPAPGPPAPRCSRDCGCSFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFGNATGSRGC
RPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCFRECGGRAL
LTNVSSVALGSRRFGGLLPPGGGAARAGPGLSYCVWVVSATEELQPCAPGTLCPPLTLTF
SPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLHW
EANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWAGPHCRMAL
CPENCNAHTGAGTCNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLSADTASRFL
HRLGHTMVDGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGGPGPSPRSF
HAAAYVPAGRGAMYMLGGLTAGGVTRDFWVLNLTTLQWRQEKAPQTVELPAVAGHTLTAR
RGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYHEATDSLYV
FGGFRFHVELAAPSSELYSLHCPDRTWSLLAPSQGAKPHPRLFHASALLGDTMVVLGGRS
DPDEFSSDVLLYQVNCNAWLLPDLTRPASVGPPMEESVAHAVAAVGSRLYISGGFGGVAL
GRLLALTLPPDPCRLLSSPEACNQSGACTWCHGACLSGDQAHR
Download sequence
Identical sequences ENSNLEP00000024365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]