SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005030 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005030
Domain Number 1 Region: 136-316
Classification Level Classification E-value
Superfamily DNA-glycosylase 7.69e-49
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000271
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.24e-38
Family DNA repair glycosylase, N-terminal domain 0.000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005030   Gene: ENSNLEG00000004149   Transcript: ENSNLET00000005290
Sequence length 424
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:17317053:17334132:1 gene:ENSNLEG00000004149 transcript:ENSNLET00000005290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARTLLPRRMGHRTLASAPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSRASRPTPDELDAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEARLRKLGLGYRARYVSASARAILEEQGGLAWLQQLREASYEEAHKAL
CTLPGVGTKVADCICLMALDKPQAVPVDVHMWQIAQRDYSWHPTTSQAKGPSPQTNRELG
NFFRRLWGPYAGWAQAXXXXXXXXXXQLLRPLIFCQDHLREGPPIGRRDSQGEELEPQLP
SSLSSIPYRFCDHCWTKDVDDPSLVTHPSPGSRGGHMTQAWPVKVVFPLATVIGHVMQAR
LLAL
Download sequence
Identical sequences ENSNLEP00000005030 ENSNLEP00000005030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]