SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005927 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005927
Domain Number 1 Region: 893-1185
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.36e-86
Family Complement components 0.0000154
Further Details:      
 
Domain Number 2 Region: 1266-1384
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.26e-30
Family Alpha-macroglobulin receptor domain 0.0016
Further Details:      
 
Domain Number 3 Region: 729-782
Classification Level Classification E-value
Superfamily E set domains 0.00000000266
Family SVA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005927   Gene: ENSNLEG00000004794   Transcript: ENSNLET00000006236
Sequence length 1432
Comment pep:known_by_projection supercontig:Nleu1.0:GL397334.1:7343651:7486523:1 gene:ENSNLEG00000004794 transcript:ENSNLET00000006236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLTVS
VLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNSTRLSFETKRISVF
IQTDKALYKPKQEVKFRIVTLFSDFKPYRTSLNILIKDPKSNLIQQWLSQQSDLGVISKT
FQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITA
XXXXXXPVKGDVTLTFLPLSFWGKKKNITKTFKINGSANFSFNDEEMKNVMDSSNGLSEY
LDLSSPGPVEILATVTESVTGISRNASTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKV
TRADGNQLTLEERNNVVITVTQRNYTEYWSRSNSGHQKMEAVQKINYTVPQSGTFKIEFP
ILEDSSELQLKAYFLGSKSSMAVHSLFKSPSKTYIQLKTRDENIKVGSPFELVVSGNKRL
KELSYMVVSRGQLVAVGKQNSTIFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPCFS
LFLNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITVENVVHE
LELYNTGYYLGMFMNSFAVFQECGLWVLTDAKLTKDYIDGVYDNAEYAERFMEENEGHTV
DIHDFSLGSSPHVRKHFPETWIWLDTNMGSRLYQEFEVTVPDSITSWVATGFVISEDLGL
GLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITIFNYLKDATEVKVIIEKSDKFDIL
MTSSEINATGHQQTILVPSEDGATVLFPIRPTHLGEIPITVTALSPTASDAITQMILVKA
EGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPSNTVTGSERVQITAIGDALGPSINGLAS
LIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLYQREDGS
FSAFGNYDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYAWLKGHQKSNGEFWEPGRV
IHSELQGGNKSPVTLTAYIVTSLLGYRKYQPNIDVQESIRFLESEFSRGISENYTLALIT
YALSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDSWQPRSLDIEVAAYALLSHL
LQFQTSEGIPIMRWLSRQRSSLGGFASTQDTIVALKALSEFAALMNTERTNIQVTVTGPS
SPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVVYNVKASGSSRRRR
SIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPARSGMALMEVNLLSGFMVPSDAIPL
SETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVR
SYTSEVKLSFCDLCSDVQGCRPCEDGASGSHHHSLVIFIFCFTLLYFLELWL
Download sequence
Identical sequences ENSNLEP00000005927 ENSNLEP00000005927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]