SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007967 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007967
Domain Number 1 Region: 253-344
Classification Level Classification E-value
Superfamily TAFH domain-like 1.31e-33
Family TAFH domain-like 0.0000293
Further Details:      
 
Domain Number 2 Region: 654-702
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000419
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007967   Gene: ENSNLEG00000006545   Transcript: ENSNLET00000008351
Sequence length 862
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:10988569:11153920:-1 gene:ENSNLEG00000006545 transcript:ENSNLET00000008351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPATVSASGTVTMAPAGALPVRVESTPVALGAVTKAPVSVCVEPTASQ
PLRSPVGTLVTKVAPVSAPPKLSSGPRLPAPQIVAVKAPNTTTIQFPANLQLPPGTVLIK
SNSGQLMLVSPQQTVTRAETTSNITSRPAVPANPQTVKICTVPNSSAQLIKKVAVTPVKK
LAQIGTTVVTTVPKPSSVQSVAVPTSVVTVTPGKPLNTVTTLKPSSLGASSTPSNEPNLN
AENSAAVQINLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDIVIATCTTT
VTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPAAA
TGGTTAGTVLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVTLSLPAVTFGETSGAAVC
LPSVKPVVTSAGTTSDKPVIGTPIQIKLAQPGPVLSQPAGIPQAVQVKQLVVQQPSGGNE
KQVTTISHSSALTIQKCGQKTMSVNTVIPTSQFPPASILKQITLPGNKILSLQASPTQKN
KIKENGTSCFRDEDDINDVTSMAGVNLNEENACILATNSELVGTLIQSCKDEPFLFIGAL
QKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLTTIAQHRMTTYKASENYILCS
DTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQ
IQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGTSSLTATKQLHRPRITRICLRDL
IFCMEQEREMKYSRALYLALLK
Download sequence
Identical sequences XP_003262030.1.23891 ENSNLEP00000007967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]