SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010682 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010682
Domain Number 1 Region: 2-542
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 8.5e-82
Family Acetyl-CoA synthetase-like 0.0000278
Further Details:      
 
Domain Number 2 Region: 755-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.75e-49
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 554-609
Classification Level Classification E-value
Superfamily ACP-like 0.0000589
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010682   Gene: ENSNLEG00000008681   Transcript: ENSNLET00000011200
Sequence length 1099
Comment pep:known_by_projection supercontig:Nleu1.0:GL397316.1:4722502:4771560:-1 gene:ENSNLEG00000008681 transcript:ENSNLET00000011200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLLNHDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKISISSEHVNEEK
AEEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLFDITQEDVLFLASP
LTFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASILFSHHRVTVLQATPTLLRRFGSQ
LIKSTVLSATTSLRVLALGGEAFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIP
EKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVP
LGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIEFVQQVAEELQQVESCAVTWYNQ
EKLILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPFTSHGKIDVSELNKIYLN
YINLKSENKLSGKEDLWEKLQYLWKSTLNLPEDLLRVPDESLFLNSGGDSLKSIRLLSEI
EKLVGTSVPGLLEIILSSSILEIYNHILQTVFPDEDATFRKSCATKRKLSDINQEEASGT
SLHQKAIMTFSCHNEINAFVVLSRGSQILSLNTTRFLTKLGHCSSACPSDSISQTNIQNL
KGLNSPLLIGKSKDPSCVAKVSEEGKPVMGTQKMELHVRWRSDTGKCVDASPLVVIPTFD
KSSTTVYIGSHSHRMKAVDFYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVL
RSNSGEKYWMFTTEDAVKSSATVDPTTGLIYIGSHDQHAYALDIYRKKRVWKSKCGGTVF
SSPCLNLIPHHLYFATLGGLLLAVNPATGNVIWKHSCGKPLFSSPRRCSQYVCIGCVDGN
LHCFTHFGEQVWQFSTSGPIFSSPCTSPSEQKIFFGSHDCFIYCCNMKGHLQWKFETTSR
VYATPFAFHKYNGSNEMLLAAASTDGKLWILESQSGQLQSVYELPGEVFSSPVVLESMLI
IGCRDNYVYCLDLLGGNQK
Download sequence
Identical sequences G1RBT3
XP_003268446.1.23891 ENSNLEP00000010682 ENSNLEP00000010682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]