SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013266 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013266
Domain Number 1 Region: 37-253
Classification Level Classification E-value
Superfamily L domain-like 2.72e-32
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Domain Number 2 Region: 247-355
Classification Level Classification E-value
Superfamily Immunoglobulin 2.02e-17
Family I set domains 0.038
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013266
Domain Number - Region: 374-443
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000149
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013266   Gene: ENSNLEG00000010938   Transcript: ENSNLET00000013920
Sequence length 560
Comment pep:known_by_projection supercontig:Nleu1.0:GL397364.1:6645227:6648834:-1 gene:ENSNLEG00000010938 transcript:ENSNLET00000013920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFHYFLLVLVFLDTHAAQPFCLPGCTCSEESFGRTLQCTSVSLGKIPGNLSEEFKQV
RIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPW
TAFRATPLLRVLDLKRNKIDALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKR
RQTDCGAEIVSSLVVALHDNPWVCDCRLRALVQFVKSITLPVILVNSYLICRGPLSKAGQ
LFHETELSACMKPQISTPSANVTIRVGQNVTLRCLAQASPSPSIAWTYPLSMWREFDGLL
GGKHLTPVLTSSTGEDTALSELAIPAAHLVDSGNYTCMASNSIGKSTLVISLHVQPSQAL
HAPDSLSIPSEGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVH
IGPGINTYAVDDLIPGTKYEACLSLEGQPPHQGQCVAFVTGRDAGGLEARERLLHVTVVL
CVVLLAVPVGAYAWAAQGPCSCSKWVLRCCVHRRKAPSCPPAAPQCRDGSFREHPAVCDD
GEGHIDAEGDKEKEGMEDNS
Download sequence
Identical sequences G1RJ59
XP_004091221.1.23891 ENSNLEP00000013266 ENSNLEP00000013266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]