SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014776 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014776
Domain Number 1 Region: 72-172
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.14e-29
Family 2Fe-2S ferredoxin-related 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014776   Gene: ENSNLEG00000012175   Transcript: ENSNLET00000015520
Sequence length 186
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:1630355:1636588:-1 gene:ENSNLEG00000012175 transcript:ENSNLET00000015520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVMAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVAPGTTRKFQATGSRPAGEED
AGGPERPGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVY
VSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDG
YVPKPH
Download sequence
Identical sequences G1RNG2
ENSNLEP00000014776 XP_003275784.1.23891 ENSNLEP00000014776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]