SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017420 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017420
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 3.66e-119
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017420   Gene: ENSNLEG00000014268   Transcript: ENSNLET00000018289
Sequence length 367
Comment pep:known_by_projection supercontig:Nleu1.0:GL397442.1:1928699:1934210:1 gene:ENSNLEG00000014268 transcript:ENSNLET00000018289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLHILTDALVPYLVGQVAAGAQALQLFESHAGHLGPQLFNKFALPYIRDV
AKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVT
LQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
Download sequence
Identical sequences ENSNLEP00000017420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]