SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019080 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019080
Domain Number 1 Region: 131-224
Classification Level Classification E-value
Superfamily TAFH domain-like 3.79e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 418-465
Classification Level Classification E-value
Superfamily Histone-fold 2.26e-17
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019080   Gene: ENSNLEG00000015722   Transcript: ENSNLET00000020041
Sequence length 631
Comment pep:known_by_projection supercontig:Nleu1.0:GL397551.1:141542:230917:-1 gene:ENSNLEG00000015722 transcript:ENSNLET00000020041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPII
ARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQR
TVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEA
EDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPASQATTALT
AVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIR
PPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAA
AQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLL
QAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRY
EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQ
ELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQR
ITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSNLEP00000019080 XP_004062527.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]