SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021908 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021908
Domain Number 1 Region: 1087-1218,1281-1347
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-37
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000235
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000222
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021908   Gene: ENSNLEG00000018035   Transcript: ENSNLET00000023016
Sequence length 1347
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:6704638:6724606:1 gene:ENSNLEG00000018035 transcript:ENSNLET00000023016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDAICNCDYNCQHYMECCPDF
KRVCTVELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
PPSRSSQTIKSTTKRSPKPPNKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSSTIR
KIKSSKNSAANRELQKKLKVKDNKKNRTKKKPTPKPPVVDEAGSGLDNGDFKVTTPDMST
TQNNKVTTSPKITTAKPINPRPSLPPNSDTSKEMSLTANKETTVETKETTTTNKQTSTDG
KEITSAKETQSVEKTSAKDLAPTSKVPAKPTPKAETTTKGPAFTTPKEPTPTTPKEPTST
TPKEPVPTTTKSAPTTPKEPAPTTPKEPSPTTTKEPAPTTPKEPAPTTPKEPSPTTPKEP
APTTTKSAPTTPKEPAPTTPKEPAPTTPKKPAPTTPKEPAPTTPKEPASTTPKEPAPTTI
KSAPTTPKEPAPTTPKEPVPTTTKKPAPTTPKKPXXXXXXXXXXXXXXXXXXXXEPSPTT
KEPSPTTPKEPAPTTPKEPAPTTPKEPPTTPKEPAPSTPKKLTPTTPKLIPTTPEKPSPT
TSEEPAPTTPEEPAPTTPEDPAPTTPEEPAPTTPEEPAPTTPKAPAPTIPKEPAPTTPKE
TAPTTPKETAPTTPKETAPTTPKETPPTTPKETPPTTPKETAPTTPKETPPTTPKETAPT
TPKETPPTTPKGTPPTTLEEPAPTTPKKPAPKELAPTTTKEPTSTTSDKPAPTTPKEPKP
TTPKKPAPTTPETPPPTTSEVSTPTTTKEPPTSHKSPDESTPELSAEPTPKALENSPKEP
GVPTTKTPAVIKPEMTTIAKDKTTERDIRTTPETTTAAPKMTKETATTTEKTTESKITTT
TTQVTSTTQDTTTFKIMTLKTTLAPKVTTTTKKTISTTEIMNKPEETAKPKDRATNSKAT
TPKPQKPTKAPKKPTSTKKPKTMPRVRKPKTTPTPRKTTSTMPELNPTSRAAEAMLQTTT
RPNQTPNSKLVEVNPKNEDAGGAEGETPHVLPRPHVFMPEVTPDMDYLPRVPNQGIIINP
MLSDETNICNGKPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDT
VFTRCNCERKTFFFKDSQYWRFTNDIKDAGYPKPIFKGFGGLTGQIVAALSIAKYKNWPE
SVYFFKRGGSIQQYIYKQEPVQKCPGRRPALNYPVYGEMTQVRRRRFERAIGPSQTHTVR
IHYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYN
IDVPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences ENSNLEP00000021908 ENSNLEP00000021908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]