SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001839 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001839
Domain Number 1 Region: 52-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 2 Region: 124-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000589
Family LDL receptor-like module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001839   Gene: ENSNLEG00000001512   Transcript: ENSNLET00000001945
Sequence length 281
Comment pep:novel supercontig:Nleu1.0:GL397524.1:878173:884651:-1 gene:ENSNLEG00000001512 transcript:ENSNLET00000001945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGGWMARVGARRTGALGLALLLLLGLGLGLEAAATPLSTPTSARAAGPSSGSCPPTKFQC
RTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQNGQCLPPSGLPCPCTGVSDCSGGTD
KKLRNCSRLACPAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTM
GSPVTLESVTSLGNATIMGPPVTLESVTSVGNATSSSAGDQSGSPAAYVVIAAAAVLSTS
LVAATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Download sequence
Identical sequences ENSNLEP00000001839 ENSNLEP00000001839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]