SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006015 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006015
Domain Number 1 Region: 1-347
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.44e-73
Family ADP-ribosylglycohydrolase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006015   Gene: ENSNLEG00000004967   Transcript: ENSNLET00000006327
Sequence length 357
Comment pep:novel supercontig:Nleu1.0:GL397284.1:26093153:26102819:1 gene:ENSNLEG00000004967 transcript:ENSNLET00000006327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMH
LATAEALVEAGKAPKLTRLYYLLAKHYQDCMEDMDGRAPGNASVHNAMQLKPGKPNGWRI
PFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTA
YAVNARPPLQWGKGLMELLPEAKKYVVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE
SAPTFPEPFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
Download sequence
Identical sequences G1QYJ4
ENSNLEP00000006015 ENSNLEP00000006015 XP_003261903.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]