SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008737 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008737
Domain Number 1 Region: 273-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.01e-61
Family Hemopexin-like domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 101-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-54
Family Matrix metalloproteases, catalytic domain 0.00000558
Further Details:      
 
Domain Number 3 Region: 18-96
Classification Level Classification E-value
Superfamily PGBD-like 8.01e-21
Family MMP N-terminal domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008737   Gene: ENSNLEG00000007170   Transcript: ENSNLET00000009154
Sequence length 513
Comment pep:novel supercontig:Nleu1.0:GL397262.1:35799699:35813743:-1 gene:ENSNLEG00000007170 transcript:ENSNLET00000009154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLLLLFLFFITFSSAFSSVWMMENEENVQLAQAYLNQFYSLEIEGNHLVQSKNKTLID
DKIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWRKYNLTYRIINYTP
DMARAAVDEAIQEGLEVWSKVTPLKFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLG
HAFPPGPGLGGDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS
LDPRKYPLSQDDINGIQSIYGGLPKVPAKPKEPTIPHACDPDLTFDAITTFRREVMFFKG
RHLWRIYYDITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDY
PKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEITQTMDKGFPQRVVKHFPG
ISIRVDAAFQYKGFFYFSRGSKQFEYDIKTRNITRIMRTNTWFQCKEPKNSSFGFDINKE
KAHSGGIKILYHKSLSLFIFGVVHLLKNTSIYQ
Download sequence
Identical sequences G1R6B5
ENSNLEP00000008737 XP_003253100.1.23891 ENSNLEP00000008737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]