SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009838 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009838
Domain Number 1 Region: 103-161
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.29e-50
Family Skp1 dimerisation domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 4-69
Classification Level Classification E-value
Superfamily POZ domain 5.27e-42
Family SCOPe 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009838   Gene: ENSNLEG00000008051   Transcript: ENSNLET00000010312
Sequence length 163
Comment pep:novel supercontig:Nleu1.0:GL397305.1:1574457:1594976:-1 gene:ENSNLEG00000008051 transcript:ENSNLET00000010312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences A0A087RF33 A0A091EML7 A0A091FLK0 A0A091HAB7 A0A091IR57 A0A091JNS7 A0A091KFG6 A0A091L579 A0A091N9F7 A0A091PXT3 A0A091QPM1 A0A091QQ78 A0A091S9P3 A0A091UZE4 A0A091VEM4 A0A093F174 A0A093FTM2 A0A093H3B1 A0A093NN46 A0A093PZ83 A0A094L5X1 A0A094N918 A0A096N478 A0A099ZGX0 A0A099ZZ65 A0A0B8RTL0 A0A1L8GR29 A0A1S2ZIQ6 A0A1S3GDW2 A0A1U7RN31 A0A1U7UFK1 A0A1W7RD42 A0A218V2V1 A0A226PAC5 A0A250YAN1 A0A287ARU4 A0A287DA97 A0A2I0MA45 A0A2I2UBL0 A0A2I4C1J5 A0A2K5C6S3 A0A2K5JHI0 A0A2K5NLF6 A0A2K5XXF4 A0A2K6RMZ3 B8QGA5 F6S4R4 F6U7N7 G1KB17 G1MHH9 G1N8G6 G1QDM4 G1R9E8 G1TTU6 G3H2C9 G3RZC5 G3THP4 G3WVY6 G5BN11 H0XJI0 H0YSS0 I0FL62 J3S9L3 K7D5S6 K7FBE0 L8IUM2 L8Y4P9 M3Z4W8 P63208 P63209 Q28CT2 Q3ZCF3 Q4R5B9 Q5R512 Q5ZKF5 Q71U00 S7PWM0 T1E4Q8 U3CKA4 U3EQQ8 U3J669 U3JZR0
ENSMLUP00000021807 ENSP00000231487 ENSP00000429686 ENSP00000429961 ENSFCAP00000024554 ENSGGOP00000021168 ENSMPUP00000018630 ENSACAP00000002616 ENSSHAP00000019591 HGL_H00000231487-6 ENSBTAP00000035184 ENSTTRP00000015982 ENSPVAP00000011716 ENSTBEP00000013485 ENSECAP00000003150 ENSPSIP00000005350 ENSTSYP00000009784 ENSBTAP00000035184 ENSPPYP00000017649 ENSPVAP00000011716 ENSECAP00000003150 ENSXETP00000035098 4i6j_C 5k35_B 5xyl_A ENSMPUP00000018630 ENSPSIP00000005350 ENSLAFP00000014113 ENSGALP00000010447 ENSTTRP00000015982 13616.ENSMODP00000017714 28377.ENSACAP00000002616 59729.ENSTGUP00000001331 8364.ENSXETP00000035098 9031.ENSGALP00000010447 9361.ENSDNOP00000010084 9598.ENSPTRP00000029490 9600.ENSPPYP00000017649 9606.ENSP00000231487 9796.ENSECAP00000003150 9913.ENSBTAP00000035184 9986.ENSOCUP00000020468 ENSMODP00000017714 NP_001006153.1.86415 NP_001016519.1.99540 NP_001029953.1.59421 NP_001029953.1.76553 NP_001080844.1.7800 NP_001127637.1.23681 NP_001138250.1.54773 NP_001138250.1.66739 NP_001166486.1.53824 NP_001180519.1.72884 NP_001239337.1.84170 NP_733779.1.87134 NP_733779.1.92137 XP_001166401.1.37143 XP_001365828.1.35504 XP_001504454.1.31192 XP_002189695.1.42559 XP_002710256.1.1745 XP_002744631.2.60252 XP_002912957.1.58354 XP_003210511.1.16129 XP_003217442.1.98722 XP_003266429.1.23891 XP_003404541.1.64505 XP_003756510.1.9362 XP_003782238.1.62490 XP_003829328.1.60992 XP_004042554.1.27298 XP_004087328.1.23891 XP_004087330.1.23891 XP_004282170.1.21590 XP_004315628.1.83887 XP_004384776.1.4749 XP_004420252.1.5094 XP_004475966.1.11602 XP_004475967.1.11602 XP_004586464.1.84141 XP_004609922.1.94378 XP_004686782.1.23501 XP_004833938.1.14098 XP_005011293.1.99704 XP_005053826.1.66865 XP_005053827.1.66865 XP_005147324.1.78019 XP_005242817.1.75256 XP_005309516.1.60341 XP_005309517.1.60341 XP_005335803.1.77405 XP_005376193.1.28644 XP_005418741.1.5688 XP_005483646.1.73095 XP_005503539.1.63277 XP_005503540.1.63277 XP_005503541.1.63277 XP_005503542.1.63277 XP_005523556.1.90289 XP_005865627.1.60319 XP_005874603.1.60319 XP_005890476.1.15283 XP_005971965.1.78601 XP_005971966.1.78601 XP_006017273.1.24877 XP_006042870.1.26621 XP_006042871.1.26621 XP_006086658.1.53796 XP_006086659.1.53796 XP_006116123.1.96668 XP_006166919.1.99106 XP_006179675.1.101512 XP_006212870.1.17985 XP_006262222.1.47583 XP_006731090.1.47382 XP_006731091.1.47382 XP_006872968.1.41390 XP_006888129.1.29581 XP_006923190.1.64745 XP_006991393.1.50099 XP_006991394.1.50099 XP_007087805.1.5354 XP_007113848.1.24612 XP_007113849.1.24612 XP_007172204.1.59432 XP_007519971.1.11023 XP_007626781.1.69978 XP_007626788.1.69978 XP_007941948.1.48129 XP_008064062.1.4292 XP_008102969.1.98722 XP_008493696.1.100939 XP_008508283.1.77740 XP_008630876.1.15636 XP_008689834.1.72690 XP_008826075.1.79516 XP_008920427.1.51550 XP_008920427.1.96775 XP_008989458.1.60252 XP_009078184.1.14518 XP_009284199.1.47732 XP_009284200.1.47732 XP_009284201.1.47732 XP_009320992.1.49731 XP_009320993.1.49731 XP_009462603.1.38621 XP_009476989.1.14425 XP_009502640.1.22320 XP_009560800.1.62272 XP_009572384.1.87690 XP_009645160.1.23211 XP_009677521.1.43253 XP_009708765.1.71050 XP_009813295.1.37116 XP_009863050.1.31609 XP_009889170.1.48241 XP_009909217.1.92783 XP_009942373.1.35112 XP_009950755.1.99599 XP_009975389.1.75343 XP_009988789.1.11325 XP_009993802.1.85724 XP_010018448.1.70042 XP_010073266.1.40768 XP_010128829.1.88979 XP_010144482.1.100080 XP_010173010.1.30499 XP_010192649.1.17318 XP_010208517.1.23224 XP_010218303.1.20684 XP_010294739.1.48707 XP_010303849.1.13389 XP_010358251.1.97406 XP_010388972.1.2935 XP_010388974.1.2935 XP_010638027.1.5607 XP_010842821.1.44457 XP_010969918.1.22495 XP_010969919.1.22495 XP_010979811.1.51371 XP_010979817.1.51371 XP_011280406.1.62641 XP_011360612.1.92234 XP_011569489.1.59079 XP_011806500.1.43180 XP_011806501.1.43180 XP_011806502.1.43180 XP_011824615.1.47321 XP_011824616.1.47321 XP_011824617.1.47321 XP_011945646.1.92194 XP_012032922.1.66739 XP_012296106.1.9421 XP_012369533.1.9945 XP_012369975.1.9945 XP_012371061.1.9945 XP_012386393.1.11602 XP_012617627.1.48125 XP_012814480.1.99540 XP_012886439.1.60039 XP_013031432.1.65836 XP_013158959.1.75256 XP_013158960.1.75256 XP_013218577.1.77405 XP_013801345.1.3284 XP_013873872.1.33752 XP_013913887.1.67126 XP_014108705.1.90289 XP_014108706.1.90289 XP_014108707.1.90289 XP_014108708.1.90289 XP_014136545.1.10750 XP_014136546.1.10750 XP_014136547.1.10750 XP_014309398.1.53796 XP_014309399.1.53796 XP_014309400.1.53796 XP_014332044.1.15283 XP_014394613.1.60319 XP_014394614.1.60319 XP_014394615.1.60319 XP_014394616.1.60319 XP_014394617.1.60319 XP_014394618.1.60319 XP_014394619.1.60319 XP_014394620.1.60319 XP_014394621.1.60319 XP_014394623.1.60319 XP_014394624.1.60319 XP_014394625.1.60319 XP_014410449.1.101512 XP_014651544.1.5094 XP_014701909.1.49734 XP_014747275.1.99236 XP_014747276.1.99236 XP_014803492.1.91963 XP_014938594.1.86478 XP_015102095.1.17985 XP_015284959.1.55130 XP_015348249.1.40921 XP_015497141.1.82291 XP_015497142.1.82291 XP_015679676.1.16292 XP_015679684.1.16292 XP_015731345.1.68032 XP_015731346.1.68032 XP_015731347.1.68032 XP_015731348.1.68032 XP_015993142.1.101085 XP_016053040.1.3490 XP_016821293.1.28591 XP_016847237.1.98722 XP_017530081.1.32401 XP_017588470.1.15636 XP_017690105.1.3805 XP_017690106.1.3805 XP_017903009.1.57651 XP_017905876.1.57651 XP_018110402.1.7800 XP_018110404.1.7800 XP_018418333.1.44173 XP_018770921.1.15306 XP_018770924.1.15306 XP_018770925.1.15306 XP_019136212.1.2935 XP_019136213.1.2935 XP_019277529.1.44245 XP_019313010.1.44245 XP_019361848.1.87953 XP_019390621.1.79039 XP_019497688.1.44202 XP_019497689.1.44202 XP_019595954.1.88060 XP_019779987.1.83887 XP_019779988.1.83887 XP_019820478.1.53367 XP_020023950.1.5219 XP_020367219.1.65276 XP_020367220.1.65276 XP_020650098.1.8467 XP_020763721.1.74333 XP_020846852.1.61212 XP_020940420.1.46622 XP_021266158.1.32913 XP_021405201.1.53032 XP_021494562.1.76796 XP_021557831.1.83697 XP_021589245.1.77405 ENSOCUP00000020468 ENSTBEP00000013485 ENSLAFP00000014113 ENSNLEP00000009838 ENSOCUP00000020468 ENSTGUP00000001331 ENSP00000231487 ENSDNOP00000010084 ENSDNOP00000021870 ENSAMEP00000018814 ENSOPRP00000006075 ENSMLUP00000021807 ENSNLEP00000009838 ENSAMEP00000018814 ENSACAP00000002616 ENSOPRP00000006075 cath|current|4i6jC00/3-162 ENSXETP00000035098 ENSPANP00000002676 ENSPANP00000007184 gi|25777713|ref|NP_733779.1| ENSMGAP00000008602 ENSOGAP00000016270 ENSGGOP00000021168 ENSGALP00000010447 gi|148222166|ref|NP_001080844| gi|32450098|gb|AAH54184| gi|54036497|sp|Q71U00| gi|6503025|gb|AAF14553| gi|7648675|gb|AAF65619| ENSTGUP00000001331 ENSOGAP00000016270 ENSP00000231487 ENSP00000429686 ENSP00000429961 ENSMODP00000017714 ENSFALP00000008264 ENSAPLP00000014996 ENSPPYP00000017649 ENSMGAP00000008602 ENSDNOP00000010084 gi|62858085|ref|NP_001016519| gi|89267388|gb|CAJ83056| ENSTSYP00000009784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]