SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010715 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010715
Domain Number 1 Region: 286-570
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-75
Family WD40-repeat 0.0000997
Further Details:      
 
Domain Number 2 Region: 212-313
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000863
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010715   Gene: ENSNLEG00000008726   Transcript: ENSNLET00000011234
Sequence length 575
Comment pep:novel supercontig:Nleu1.0:GL397281.1:6712064:6972212:1 gene:ENSNLEG00000008726 transcript:ENSNLET00000011234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVN
FLVYRYLQESVFSHSAFTFGIESHISQSNINGTLVPPAALIFLLQKGLQYVEAEISINED
GTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAATAAATAATTTSAGV
SQQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVEIPSSKATVLRGHESEVFICAWNP
VSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNGTL
LATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHTGE
AKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDP
SGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASAS
FDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHS
YRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Download sequence
Identical sequences ENSNLEP00000010715 ENSNLEP00000010715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]