SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016829 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016829
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily Ribosomal protein L20 3.14e-19
Family Ribosomal protein L20 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016829   Gene: ENSNLEG00000013868   Transcript: ENSNLET00000017681
Sequence length 83
Comment pep:novel supercontig:Nleu1.0:GL399518.1:5793:9557:-1 gene:ENSNLEG00000013868 transcript:ENSNLET00000017681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALANRRRHE
GFAAALGDGKEPEGIFSRVVQYH
Download sequence
Identical sequences ENSNLEP00000016829 XP_003282723.3.23891 ENSNLEP00000016829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]