SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017005 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017005
Domain Number 1 Region: 507-631
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.38e-18
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 1140-1202
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.62e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 3 Region: 632-758
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-17
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 4 Region: 1304-1367
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 5 Region: 728-794,821-884
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000102
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 878-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family EGF-type module 0.0022
Further Details:      
 
Domain Number 7 Region: 313-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000599
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 1496-1579
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000785
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 951-1094
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000879
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 244-310
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000719
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 11 Region: 794-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000059
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 12 Region: 1212-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000331
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1247-1297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 114-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000359
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017005   Gene: ENSNLEG00000013974   Transcript: ENSNLET00000017865
Sequence length 1584
Comment pep:novel supercontig:Nleu1.0:GL397330.1:1119044:1149883:-1 gene:ENSNLEG00000013974 transcript:ENSNLET00000017865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLFVAAARARRLGGAAASESLAVSEASCRVRSCQPKKCAGPQRCLNPVPAVPSPSPSVR
KRQVSLNWQPLTLQEARALLKRRRSRGPGGRGLLRRRPPQLAPAGKAPVLCPLICHNGGV
CVKPDRCLCPPDFAGKFCQLHSSGARPPAPAIPGLTRSVYTMPLANHRDDEHGVASMVSV
HVEHPQEASVVVHQVERVSGPWEEADAEAVARAEAAARAEAAAPYTVLAQSAPREDGYSD
ASGFGYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGVHDCQLCSERLGNSERVSAPGG
PCPTGFERVNGSCEDVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVI
SEAKGPCFRVLRDGGCRPLPETPPWHSIFCLKLNPTRELFPSLQLCPFWACHQGFREICP
AGPGYHYSASDLRYNTRPLDQEPPRVSLSQPRTLPATSRPSAGFLPTRRPEPRPEARPDP
RPGPELPLPSIPAWTGPEIPESGPSSGMCQRNPQVCGPGRCISRPSGYTCACDSGFRLSP
QGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPC
DLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQTPGLCGRGACKNLPGSFHCVCPA
GFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFHSRGPGAPCQDVDECARSP
PPCTYGRCENTEGSFQCVCPMGFQPNAAGSECEDVDECENHLACPGQECVNSPGSFKCRA
CPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVN
ECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDG
SFECICPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCEPGYHAGLE
GTCDDVDECQDYGPEICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCG
AHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPN
SPEEFDPMTGRCVPPRTSAGTFPGSQPLAPASPVLPARPPPPPPPRRPSTPRQGPLGSGR
RECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRG
YLAPSGDPSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTRRLECIDNDEC
ADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGADLV
CSHPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVLRPPAYSPPRPGGFGL
PYEYGPDLGPPYQGLPYGPELYPPPALPYDPYPPPPGPFARREAPYGAPRFDMPDFEDDG
GPYGESEAPVPPGPGTRWPYRSRDTRRSFPEPEEPPEGGSYAGSLGEPYEELEAEECGIL
DGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSF
RCICRPGFAPTHQPHHCAPARPRA
Download sequence
Identical sequences ENSNLEP00000017005 ENSNLEP00000017005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]