SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017957 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017957
Domain Number 1 Region: 313-508
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.68e-70
Family Hemopexin-like domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 115-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.49e-56
Family Matrix metalloproteases, catalytic domain 0.0000000236
Further Details:      
 
Domain Number 3 Region: 25-98
Classification Level Classification E-value
Superfamily PGBD-like 2.51e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017957   Gene: ENSNLEG00000014762   Transcript: ENSNLET00000018851
Sequence length 582
Comment pep:novel supercontig:Nleu1.0:GL397280.1:2000665:2011935:1 gene:ENSNLEG00000014762 transcript:ENSNLET00000018851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVGNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Download sequence
Identical sequences ENSNLEP00000017957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]