SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020175 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020175
Domain Number 1 Region: 75-290
Classification Level Classification E-value
Superfamily FKBP-like 1.06e-30
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020175   Gene: ENSNLEG00000016599   Transcript: ENSNLET00000021183
Sequence length 1220
Comment pep:novel supercontig:Nleu1.0:GL397294.1:6983613:7045076:-1 gene:ENSNLEG00000016599 transcript:ENSNLET00000021183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGAGDEDDTDFLSPSGGARLASLFGLDQAAAGHGNEFFQYTAPKQPKKGQGTAATGNQA
TPKTAPATMSTPTILVATAVHAYRYTNGQYVKQGKFGAAVLGNHTAREYRILLYISQQQP
VTVARIHVNFELTVRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDA
VLSQDLIVADGPAVEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKG
WEDGMLGMKKGGKRLLIVPPACAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSDGH
SVSSRDSAAPSPIPGADNLSADPVLSPPTSIPFKSGEPALRTKSNSLSEQLAINTSPDAV
KAKLISRMAKMGQPMLPILPPQLDSNDSEIEDVNALRGGGQPVVTPSIQPSLQPAHPALP
QMTSQAPQPSVSGLQAPSAALMQVSSLDSHSTLSGNAQSFQPYAGMQAYAYPQASAVTSQ
LQPVRPLYPAPLSQPPHFQGSGDMASFLMTEARQHNTEIRMAVSKVADKMDHLMTKVEEL
QKHSAGNSMLVPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIE
RNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMT
AHQKKETELQMQLTESLKETDLLRGQLTKVQAKLSELQETSEQSQSKFKSEKQSRKQLEL
KVTSLEEELTDLRVEKESLEKNLSERKKKSAQERSQAEEEIDEIRKSYQEELDKLRQLLK
KTRVSTDQAAAEQLSLVQAELQTQWEAKCEHLLASAKDEHLQQYQEVCAQRDAYQQKLVQ
LQEKCLALQAQITALTKQNEQHVKELEKNKSQMSGVEAAASDPSEKVKKIMNQVFQSLRR
EFELEESYNGRTILGTIMNTIKMVTLQLLNQQEQEKEESSSEEEEEKAEEQPRRPSQEQP
ASASSGQPEAPLNRERPESPMVPSEQVVEEAVLLPPQALTTSQDGVHRRKGDSEAETLSE
IKDGSLPPELSCIPSHRVLGPPTSIPPEPPGPVSVDSECEESLAASPVAAKPDNPPGKVC
VREVAPDGPLQESSTRLSLTSDPEKGDPLALGPESPGEPQPPQLKKDDVTSSTGPHEELS
STETGSTVAGAALRPSHHSQHSSLSGDEEDELFKGATLKALRPKAQPEEEDEDEVSMKGR
PPPTPLFGDDDDDDDIDWLG
Download sequence
Identical sequences ENSNLEP00000020175 ENSNLEP00000023563 ENSNLEP00000020175 XP_003264064.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]