SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021501 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021501
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 2.61e-81
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 379-481
Classification Level Classification E-value
Superfamily Integrin domains 2.14e-24
Family Integrin domains 0.0034
Further Details:      
 
Domain Number 3 Region: 644-716
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000222
Family Integrin beta tail domain 0.0089
Further Details:      
 
Domain Number 4 Region: 42-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000131
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 602-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family Integrin beta EGF-like domains 0.0079
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021501
Domain Number - Region: 531-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021501   Gene: ENSNLEG00000017715   Transcript: ENSNLET00000022592
Sequence length 798
Comment pep:novel supercontig:Nleu1.0:GL397261.1:59314149:59330976:1 gene:ENSNLEG00000017715 transcript:ENSNLET00000022592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALPVVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSPLGSCQPAASCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
IQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVRISYESQCEGPEKREG
KAEDRGRCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSEAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCSDGYYGALCDQCPGCKTPCERHRDCAECGAFGTG
PLATNCSTACAHTNVTLALGPILDDGWCKERTLDNQLFFFLVEDDTRGRVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
Download sequence
Identical sequences ENSNLEP00000021501 ENSNLEP00000021501 ENSNLEP00000023995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]