SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470167659|ref|YP_007548746.1| from Bibersteinia trehalosi USDA-ARS-USMARC-192

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470167659|ref|YP_007548746.1|
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.73e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470167659|ref|YP_007548746.1|
Sequence length 114
Comment NTP binding protein (Contains STAS domain) [Bibersteinia trehalosi USDA-ARS-USMARC-192]
Sequence
MQTKNPLQWGVQQNNESLMVQLSGELNRDTLLPLWKQRASFLSPKANQHLYWDLKGLTSI
DSAGFALLAELLNHYHKSTPCSLINAPESLLKLAELFDLSEWFASFLHSPSGYK
Download sequence
Identical sequences M4R751 W0R835
gi|470167659|ref|YP_007548746.1| WP_015433091.1.25236 WP_015433091.1.27701 WP_015433091.1.48858 WP_015433091.1.96115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]