SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374312133|ref|YP_005058563.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374312133|ref|YP_005058563.1|
Domain Number 1 Region: 577-902
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.35e-121
Family Methionine synthase SAM-binding domain 0.0000000178
Further Details:      
 
Domain Number 2 Region: 26-299
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 4.97e-89
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0018
Further Details:      
 
Domain Number 3 Region: 419-571
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.96e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000104
Further Details:      
 
Domain Number 4 Region: 323-409
Classification Level Classification E-value
Superfamily Methionine synthase domain 8.89e-26
Family Methionine synthase domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374312133|ref|YP_005058563.1|
Sequence length 904
Comment methionine synthase [Granulicella mallensis MP5ACTX8]
Sequence
MSTVTETKPLRLSGSQPFTQQSGVYIMIGERTNVAGSPKFAKLIKEGKYEEAVSIARQQV
ENGANVIDICMDEGMIDGAVAMTRYLQLLGSEPEVAKVPFMVDSSKWEVIEAGLKCLQGK
GIVNSISLKEGEEKFRHNAATVRKYGAAVVVMAFDEQGQAATYEEKIRICERAYRILVDE
VGFPPEDIIFDPNILTVATGMEEHNNYAVDFINATRWIKANLPHAKVSGGVSNISFSFRG
NNKVREAMHSAFLYHAIAAGMDMGIVNAGMLEVYEEIEPELKVLVEDVLLNRRPDATERL
VEHGEKLKAESSGTVQDEKKIEEWRNGTVEERLSHSLVKGIDAYIDIDTEEARAKLGRPL
LVIEGPLMDGMGVVGDLFGAGKMFLPQVVKSARVMKKAVAYLTPFMEAEKAAMLAAGQEV
KAQGKIVLATVKGDVHDIGKNIVGVVLACNNYEVIDMGVMVSSEKILERAKAEKADLIGL
SGLITPSLDEMVHVAKEMERQGFKLPLLVGGATTSRAHTAVKIAPHYSEPVVHVLDASRA
VPVTTSLLSEDGKEEFVARHRADYEALRKSHASPRQKTVSLETARSRRTPIEWRAEDLAV
PEFTGVRVLDNFPLATLREFIDWSPFFHTWGLKGIYPRIFDHPEHGAQARQVFTEGNALL
DTIIEKNLITARGVYGFFPASAVGDDVELYTDGIRTEVLDRFHFLRQQANREGTEPCRSL
ADFIAPKETGLLDYIGAFAVTSGIGLKELCDRFRAENDDYNAIMAEAIADRLAEAFAECL
HKRVRDEWGYGHAEGLSPAELIQEKYRGIRPAPGYPGCPDHTEKGTLWQLLDVQANTSMQ
ITESFAMWPGSSVSGIYFAHPESRYFSLGKIDRDQVVDYHKRKGMSVAEVERWLGQNLNY
EPAE
Download sequence
Identical sequences G8NTX7
gi|374312133|ref|YP_005058563.1| WP_014266407.1.98070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]