SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374312134|ref|YP_005058564.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374312134|ref|YP_005058564.1|
Domain Number 1 Region: 7-363
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 7.32e-86
Family Homocysteine S-methyltransferase 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374312134|ref|YP_005058564.1|
Sequence length 366
Comment Methionine synthase [Granulicella mallensis MP5ACTX8]
Sequence
MTKAHQHPLEKILESRIAIIDGAMGTTIRTYGMTEADIRGERFKDSKKDLLNNGDLFSLT
QPKMICDIHRRFLEAGADIIETNTFGATGITQSEFFVDDPREHGGRKDPEFYQKIIEDKF
LNDLAWEINEQSARQCREWADRTANETGRQRFVAGAIGPLTVSLSNSPDADDSGFRVVTF
DQVKAAYVQQVRALIAGGSDLLLVETIFDSLNAKAALVAIREVFDQDGLTSNNKELPVMI
SAAVGRGGETLISAQTTEAFWNAVQHVKPLSVGLNCSLGPDLMYPFLEELSEKADVAISC
YPNAGLPNPLSETGFDLGPQDMARYLGDFARGGLINIAGGCCGNTPEHIAAIAKALDGKA
PRELGA
Download sequence
Identical sequences G8NTX8
gi|374312134|ref|YP_005058564.1| WP_014266408.1.98070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]