SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374312989|ref|YP_005059419.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374312989|ref|YP_005059419.1|
Domain Number 1 Region: 34-277,342-373
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.22e-80
Family Type II chitinase 0.00000993
Further Details:      
 
Domain Number 2 Region: 277-341
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000151
Family Chitinase insertion domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374312989|ref|YP_005059419.1|
Sequence length 392
Comment glycoside hydrolase family protein [Granulicella mallensis MP5ACTX8]
Sequence
MNERRRDFPSFWSPLRLTVLGALTLLNGFHAIAEPKVPPQKAIVAYVFLKDRTLQPNEIA
VNKLTRINYAFANIRGGRIVNGFKNDDQNLADLVALKQQNPSLTVLVSVGGWEWSDSFSD
MVLTKASRREFIASVTDYVQRHQLDGLDIDWEYPGMAGSTNHFRPEDTRNFTLLLKELRA
SFKHQERKLHRQLYLTIAAGASSGYIANTEMDKVQQYIDTVNLMAYDYYGSEKTTGNHAP
LFTDPNDPQKISADRSVHEFEQAGVPAEKIVLGVPFYGHRWGDVADVQHGLFQAGTPLPQ
GYTQYSIVSTTLLNNGFDRYWDKAASVPYLYSPSQKIFVSYEDTESLALKARYVMDQHLG
GIMFWDYDGDPSGTLLDTVHTGLTQPTADKAP
Download sequence
Identical sequences G8NQS6
WP_014267260.1.98070 gi|374312989|ref|YP_005059419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]