SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374313103|ref|YP_005059533.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374313103|ref|YP_005059533.1|
Domain Number 1 Region: 89-192
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 5.49e-26
Family Sigma2 domain of RNA polymerase sigma factors 0.0007
Further Details:      
 
Domain Number 2 Region: 208-276
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000000000000185
Family Sigma4 domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374313103|ref|YP_005059533.1|
Sequence length 279
Comment ECF subfamily RNA polymerase sigma-24 subunit [Granulicella mallensis MP5ACTX8]
Sequence
MKSSRTPVTPPSEPRAEVDDPQFPAESDDLPQPEAEDGVSEDMGTLAIHPGLLNTPQDVH
LPADRPLGAEALTPEQARIRAEAIARGDFSQLSDAEVMLELRSGNLAAFDILLAKYRKPI
IHFMFRMVHNQAVAEELAQEVFLRIYRSRETYRAEARFSTWLYRIATNLGVNHARDTRHE
RSASTIYLDETDAETGTTPDVADSTPSAEANMLRRERMNAIRQHVLALPERQQHAVLMHK
YEGMDYKQIGEVLKLSESATKSLLFRAYQTLREKLKDFV
Download sequence
Identical sequences G8NRR2
WP_014267374.1.98070 gi|374313103|ref|YP_005059533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]