SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374309563|ref|YP_005055993.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374309563|ref|YP_005055993.1|
Domain Number 1 Region: 79-180
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 4.06e-26
Family Sigma2 domain of RNA polymerase sigma factors 0.0028
Further Details:      
 
Domain Number 2 Region: 204-267
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 5.23e-17
Family Sigma4 domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374309563|ref|YP_005055993.1|
Sequence length 274
Comment ECF subfamily RNA polymerase sigma-24 subunit [Granulicella mallensis MP5ACTX8]
Sequence
MATATIPAIFEQDSRVLLGARILRREPLTPPSGRDSRPERLPLQEIPMTEARLSPQDPDP
QREPLPQVQEQRAAAAAEQARLAELAVRCLQGDADAWEKLATGQHRRIYGICYRFTGSAT
EAEDMTQEVFLKMFKNLASFDPAKGGFTTWLTTLTRNLLVDSYRRSRMDRVSDSLDETYD
GEDDGPSKAEKLADTRPGQEHHMAGLELRAQIQQALAQVSPDLREAVILRDLEDMDYKEI
AEILGVPQGTVKSRISRGRSELAKLLKRIEGQVM
Download sequence
Identical sequences G8NQA7
WP_014263847.1.98070 gi|374309563|ref|YP_005055993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]