SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374309791|ref|YP_005056221.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374309791|ref|YP_005056221.1|
Domain Number 1 Region: 18-202
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-56
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 286-478
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.47e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1056-1215
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-29
Family Histidine kinase 0.0045
Further Details:      
 
Domain Number 4 Region: 215-285
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000392
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0092
Further Details:      
 
Domain Number 5 Region: 990-1057
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000765
Family Homodimeric domain of signal transducing histidine kinase 0.009
Further Details:      
 
Domain Number 6 Region: 848-936
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000649
Family Flavin-binding PAS domain 0.085
Further Details:      
 
Domain Number 7 Region: 737-849
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000109
Family Flavin-binding PAS domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374309791|ref|YP_005056221.1|
Sequence length 1219
Comment signal transduction histidine kinase with CheB and CheR activity, partial [Granulicella mallensis MP5ACTX8]
Sequence
MPSSPVQRPPPKKTSLEIPVVAIGASAGGLEALTAILRALPTDIAMAFMLIQHLDPKRHS
ILPELLSRATRIPVLEAVDAMKVESNHVYVMPSNVDISITDGHFGLAPRAADHKQHLPID
IFMRSLAEVRKSKAIGVILSGTGSDGTAGIKAIRAEGGVTFAQSTETAKFDGMPRSAIES
GCIDYVLSPEKIAAELAHLSSHPQVRQRPKVAREEPKSDSDVFDSILNLVSISQGSDFTK
YKPNTIHRRIQQRMAALRILSLSAYLTYLREHPEEVAKLSHHVLIPVTEFFRNPETFEDL
AKTVFPAMIEEKAGEALRLWVVACSTGEEVYSLAITLLEFLGTRAEGMRIQIFGTDINEK
GIAKARSGIYSESAMKNVSAERTANFFTKVAGGYRANKVIRDLCVFARQDVTKDPPFSSL
DLISCRNFLIYVEPELQERIISTLHYALNPSGFLLLGNAESAASYPQMFTPLNKKSKIYS
KKVGDHRQQRTFKTSRAPLQAIDSPIEKALPISRASQNEQELQQLADRMVLRECAPPGVI
VNDALEILQFRGRTSPYLEPASGRANLNILNMVREELAIALRTAIASARKKAAPIKKKNV
AFEHNGKKRVVHLSVVPMDELVSGVGRCYLILFEDVASLIDPNGKADRPLPLQPGDLSRR
TLLDQKRELQATRTLLKEHTRAQEALREDYQSANEEMLSANEELQSTNEELETSKEELQA
TNEELNTVNDELNSNNAALHLLGNDLKNLLESTVIPIVMVDGNLCIRRMTPTAEAVFKVL
PSDIGRPITDINPDLNIDLKPLLTTVLRDVVSLEREVQDQQGHWYRLQVRPYETLDNRSD
GAVLVLMDIDVIKKRNQELVLASEFTKSIIETMPEPVLVLNANLHVLMANYSFYKAFEVT
PEATLNRFVYGLGNGQWNKPDLRTLLEEVLPHDRDFLNHEVIYDFPGIGWKSFMLSGRYM
VQEPEAAPLILLSLTDMTKRKKIEAALVQAEKLTIASRLAATIAHEINNPLEAITNLLYL
ASTGDDAAAAKTYAAQALEEVGRVSHITQQTLKFYRQSTAPSSVQVSEILDSLLVLYHGK
LLANNITVHRQYREGPSILCLAGDLRQIFANLLSNAVDAMRFGGSLTMRVSSSYDWRNQE
RRGIRATISDSGTGMTPKTLRKIYEPFFTTKNETGTGLGMWVSAQLVDRLQGDLRVSSTM
RRGRSGTTFSLFLPLELSA
Download sequence
Identical sequences G8NTF9
WP_014264073.1.98070 gi|374309791|ref|YP_005056221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]