SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374310635|ref|YP_005057065.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374310635|ref|YP_005057065.1|
Domain Number 1 Region: 13-93
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.0000000136
Family Sigma2 domain of RNA polymerase sigma factors 0.0031
Further Details:      
 
Domain Number 2 Region: 122-168
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000135
Family Sigma4 domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374310635|ref|YP_005057065.1|
Sequence length 194
Comment sigma-70 family RNA polymerase sigma factor [Granulicella mallensis MP5ACTX8]
Sequence
MAFVQRFQPLIASSVARVVRRYNAPSPALIDDLVQETYLRLCKDNCRALREFSAQHDEAI
FGYIKVIATSVALDHYRARATYKRRSEVEDDGTNLEASTPSSTIEQTTLLKELDRHLAST
ESQRDRTIFWLYYRQGYTAKDIAAMPNLGLTHKGVESCIYRLTQALRSAVGNVSAPSAGL
SKGDSPQSALGGLK
Download sequence
Identical sequences G8NPM3
gi|374310635|ref|YP_005057065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]