SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374313151|ref|YP_005059581.1| from Granulicella mallensis MP5ACTX8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374313151|ref|YP_005059581.1|
Domain Number 1 Region: 104-182
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000486
Family Sigma4 domain 0.034
Further Details:      
 
Domain Number 2 Region: 7-107
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.00000000385
Family Sigma2 domain of RNA polymerase sigma factors 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374313151|ref|YP_005059581.1|
Sequence length 198
Comment sigma-70 family RNA polymerase sigma factor [Granulicella mallensis MP5ACTX8]
Sequence
MEFFTFDAEYLEKLQLGDPSAEKHFVAYFSELIHLKLRSRLASREAVEDVRQETFTRVFL
MLRKSDGLRDANRLGSFVNSVCNHVLQEHYRAQKKVGSSLEEEPETVYVDRNPSPLNLLE
SKDRARLVQQALAELPGRDRDLLRAILMEDRDKDAVCAEMGVSREYLRVLLHRAKQSFRS
TYDRPPVPEEPVPRRETF
Download sequence
Identical sequences G8NSH5
WP_014267422.1.98070 gi|374313151|ref|YP_005059581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]