SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378696737|ref|YP_005178695.1| from Haemophilus influenzae 10810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378696737|ref|YP_005178695.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Urease, gamma-subunit 3.53e-45
Family Urease, gamma-subunit 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378696737|ref|YP_005178695.1|
Sequence length 100
Comment urease subunit gamma [Haemophilus influenzae 10810]
Sequence
MHLTSREQEKLMLFLAGELAAKRKARGLKLNYPETIAYIASHLQEAARDGMSVAEVMQYG
STLLTVDDVMEGVAEMVHEVQIEATFPDGTKLVTVHNPIR
Download sequence
Identical sequences A0A0Y0A6M7 A0A2J1DLR9 E1XAI9 I2NEQ4
WP_005709581.1.13403 WP_005709581.1.13610 WP_005709581.1.34925 WP_005709581.1.37452 WP_005709581.1.39974 WP_005709581.1.42267 WP_005709581.1.57312 WP_005709581.1.73206 WP_005709581.1.75193 WP_005709581.1.76737 WP_005709581.1.82376 WP_005709581.1.85362 WP_005709581.1.86649 WP_005709581.1.88810 WP_005709581.1.93392 WP_005709581.1.9761 gi|378696737|ref|YP_005178695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]