SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378697140|ref|YP_005179098.1| from Haemophilus influenzae 10810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378697140|ref|YP_005179098.1|
Domain Number 1 Region: 244-354
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000474
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378697140|ref|YP_005179098.1|
Sequence length 384
Comment formate-dependent nitrite reductase complex nrfFG subunit [Haemophilus influenzae 10810]
Sequence
MKSILDIFTRGFIQVQKTVFFATALLFAFSLFARAEMVDTYQFQNQDDRTRAVELAKSLR
CPQCQNQNLVESNSPIAYDLRLEVYKMVDEGKSNQQIIDKMTARFGDFVNYKPPFKWNTA
LLWLLPVALLILAAVLLYFSNRKKQFSEKVVAQQLENDEIISHPSTFGSSPRKQGEPSKL
SKGKVNSKIYFVLFTLLIAIPTAYYFSLDRFSRVQQGEQSMIEQHNQNVEMNDEHKNENV
IEKLQNKLRTDPNNAETWLQLGEAYVQNNEFDSALVAYSNAEKLSGSKPNILGLAATALY
YQAGQQMTPKVEQLLNEALAKDKNEVSSLSLLATIALENRQYQQASAYLQQLLDSGNAAV
DRRSVIQRMKMLDFLQRGKKGQNP
Download sequence
Identical sequences A0A110KFZ3 E1XBP3
WP_015701951.1.13610 WP_015701951.1.34925 WP_015701951.1.37452 WP_015701951.1.42267 WP_015701951.1.57312 WP_015701951.1.6054 WP_015701951.1.75193 WP_015701951.1.76737 WP_015701951.1.82376 WP_015701951.1.85362 WP_015701951.1.86649 WP_015701951.1.88810 WP_015701951.1.93392 WP_015701951.1.9761 gi|378697140|ref|YP_005179098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]