SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378697322|ref|YP_005179280.1| from Haemophilus influenzae 10810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378697322|ref|YP_005179280.1|
Domain Number 1 Region: 164-274
Classification Level Classification E-value
Superfamily TPR-like 1.66e-20
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378697322|ref|YP_005179280.1|
Sequence length 305
Comment hypothetical protein HIB_12550 [Haemophilus influenzae 10810]
Sequence
MNFTLIFILTTLVVALICFYPLLCQFKAKHGQKRDDLNKALYFSRLEEIEQDNSQGLVEN
VEQLKQELQKTLLDDVPSKVQENVDYSGKSYGKIWFISGVLALGIIAGPSYFMVGSWQAE
SMLEQTYAKLPYFFDRMKDEDKNPFSDTEMQQFSTALRIDLQKNPTDAKKWWMLGQIGMN
LGDARLAFDSYQKANKLEPDNVQYKLGYARILMFSEDATDKLKGGNLLREVIRQEHTNIE
ALSLLAFRYFETEDYKMAAVTWAMMLRLMPKDDERVPLIEKSIRTARDALEAQNEEKSKS
ITPEK
Download sequence
Identical sequences A0A0E1SQ14 A0A120SIS3 A0A2J1DPZ7 A4NWI4 E1X6R9
gi|378697322|ref|YP_005179280.1| gi|386264477|ref|YP_005827970.1| WP_005665888.1.13610 WP_005665888.1.20018 WP_005665888.1.26667 WP_005665888.1.34925 WP_005665888.1.3733 WP_005665888.1.37452 WP_005665888.1.40040 WP_005665888.1.42267 WP_005665888.1.51509 WP_005665888.1.57312 WP_005665888.1.6054 WP_005665888.1.62109 WP_005665888.1.71424 WP_005665888.1.75193 WP_005665888.1.76422 WP_005665888.1.76737 WP_005665888.1.78014 WP_005665888.1.82376 WP_005665888.1.85362 WP_005665888.1.86649 WP_005665888.1.88810 WP_005665888.1.91647 WP_005665888.1.93392 WP_005665888.1.96546 WP_005665888.1.9761 WP_005665888.1.98200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]