SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386263354|ref|YP_005826847.1| from Haemophilus influenzae R2866

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386263354|ref|YP_005826847.1|
Domain Number 1 Region: 204-339
Classification Level Classification E-value
Superfamily CBS-domain pair 2.59e-21
Family CBS-domain pair 0.0053
Further Details:      
 
Domain Number 2 Region: 346-430
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.82e-21
Family CorC/HlyC domain-like 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386263354|ref|YP_005826847.1|
Sequence length 432
Comment Putative hemolysin [Haemophilus influenzae R2866]
Sequence
MIMELFHTILAIVALILSSAVVSSAEISLASSRKLKLQSLANKGDVRALQVLKLQEHPGR
FITVVQILLNMVAILGGGIGESALSPYIADILNRSFEGSWIEPTASTIAFILVTCLFILF
ADLIPKRIAITYPEMVALSVVGIMNFSMYVFKPLVWFFDTIANVFFRLFRISTVREDGMT
SEDIFAVVEAGAEAGVLKTQEHYLIENIFDMQARTVTSTMTTRENIVYLDRTFSRQEVMD
TLSRDSHSKIVICDNGLDKILGYIESHTLLTMYLQNENVVLTDPKLLRKALFVPDTLSLY
EVLELFKSTGEDFAIIVNEYALVVGIVTLNDVMSIVMGELVSNEEEYIVSRDENSWLIDG
ATPLKEVTRVLDIAYFPDEENYETISGFMMYMLRKIPKKTDSVVYGKYKFEVIDTENFKI
DQILVSLVKEQE
Download sequence
Identical sequences A0A0E1WU46 Q4QN93
gi|386263354|ref|YP_005826847.1| gi|68249052|ref|YP_248164.1| WP_005691371.1.10621 WP_005691371.1.15261 WP_005691371.1.17459 WP_005691371.1.20018 WP_005691371.1.20853 WP_005691371.1.23065 WP_005691371.1.23149 WP_005691371.1.23920 WP_005691371.1.27712 WP_005691371.1.28397 WP_005691371.1.32414 WP_005691371.1.32618 WP_005691371.1.37003 WP_005691371.1.38938 WP_005691371.1.39279 WP_005691371.1.40040 WP_005691371.1.40343 WP_005691371.1.40942 WP_005691371.1.42240 WP_005691371.1.50588 WP_005691371.1.50795 WP_005691371.1.53947 WP_005691371.1.54653 WP_005691371.1.56005 WP_005691371.1.61426 WP_005691371.1.62109 WP_005691371.1.62697 WP_005691371.1.71424 WP_005691371.1.74240 WP_005691371.1.74810 WP_005691371.1.76348 WP_005691371.1.78014 WP_005691371.1.8829 WP_005691371.1.91188 WP_005691371.1.91769 WP_005691371.1.96546 WP_005691371.1.97721 281310.NTHI0579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]