SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473828793|ref|YP_007682076.1| from Thalassolituus oleivorans MIL-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473828793|ref|YP_007682076.1|
Domain Number 1 Region: 10-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.05e-111
Family FMN-linked oxidoreductases 0.00000000357
Further Details:      
 
Domain Number 2 Region: 340-532
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.06e-43
Family N-terminal domain of adrenodoxin reductase-like 0.0000152
Further Details:      
 
Domain Number 3 Region: 469-527,563-664
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.92e-16
Family C-terminal domain of adrenodoxin reductase-like 0.0000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|473828793|ref|YP_007682076.1|
Sequence length 686
Comment NADH:flavin oxidoreductase, Old Yellow Enzyme family protein [Thalassolituus oleivorans MIL-1]
Sequence
MTEAATMSQYPHIFEPLDLGFTTLKNRVMMGSMHTGLEDRPWHFGELAEYFAERARGGAA
LLVTGGFSPNRAGDLLPFGSKMMSSWQVPFHRKVTSAVHEADGKILLQLLHAGRYGYTPL
NVAPSAIQAPINPFKPKELSSKQIAKTIGHYARAAGLAQKAGYDGVEVMGSEGYFITQML
NKRTNQRDDEWGGSYENRMRFPLEVVKAIRAEVGDKFIVMFRLSMLDLVEEASDIDEVIL
LAQALEKAGVTLINTGIGWHEARVPTIVTSVPRGAFADITARVKAAVNIPVIASNRINMP
DTAEDILASGKADMVSMARPFLADPEWVNKAASGRTNEINTCIACNQACLDHTFANKRAS
CLVNPRACHETKLIYRQVSKAKKIAVVGAGPAGLATAVVAAERGHKVTLFEGRAEIGGQF
NYASKIPGKEEFRETIRYYETMLAKYNVELKLNHTVTEDELRSGGFDDIVVASGVAPRMP
NMPGIDHPKVVSYQDLLANNLKLGGSVAIMGAGGIGFDVGEYLTHEGESTTLNINAWMKE
WGVDLTNTIRGGLVKADVEASPRKVYLLQRKTSSHGKGLNKTTGWVHRAVLKMKRVEMIG
GVSYDSVDDQGLHITITKGESSEKRVLDVDNVVVCAGQVSVAGLYESLKDDQAAPYKVHL
VGGAEFAGELDAKRAIRMASELAATL
Download sequence
Identical sequences M5DRP0
WP_015486570.1.4929 gi|473828793|ref|YP_007682076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]