SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385799690|ref|YP_005836094.1| from Halanaerobium praevalens DSM 2228

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385799690|ref|YP_005836094.1|
Domain Number 1 Region: 11-169
Classification Level Classification E-value
Superfamily RNase III domain-like 8.72e-49
Family RNase III catalytic domain-like 0.0000275
Further Details:      
 
Domain Number 2 Region: 120-234
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.51e-25
Family Double-stranded RNA-binding domain (dsRBD) 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385799690|ref|YP_005836094.1|
Sequence length 237
Comment RNAse III [Halanaerobium praevalens DSM 2228]
Sequence
MRKLCNKRKTLKFEKSLDLNFNNKFLLERALTHKSYPNENRHLNLKDNERLEFLGDSVLS
LSISTYIFNKFSDFPEGDLAKMRAVIVSAPILAEAAKRINLGQYLFLGKGEEMTGGRERD
SILADTMEAIFGALYLDQSFKVVSDFILELLKVDIINVAAGNHIQDYKTMLQEVIQDMGN
FRPEYEVIDEEGPDHNKTFIVAVKMNEESLGSGQGSSKKEAEQEAAKVALDKLDKLD
Download sequence
Identical sequences E3DQV9
gi|385799690|ref|YP_005836094.1| WP_014552967.1.13558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]