SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385800649|ref|YP_005837053.1| from Halanaerobium praevalens DSM 2228

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385800649|ref|YP_005837053.1|
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 6.41e-21
Family YmcA-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385800649|ref|YP_005837053.1|
Sequence length 119
Comment hypothetical protein [Halanaerobium praevalens DSM 2228]
Sequence
MSKVVTKAEKLADAILESEEYKKMLKAEKVMDADKKASELVKKVEALQIKIDQNKSAEKF
KKEMASLQKKMWENEKIKSFMQKQQSFSKLMAGVNKKISQKINPQAGNHDQFDEHQDNH
Download sequence
Identical sequences E3DQB6
WP_014553910.1.13558 gi|385800649|ref|YP_005837053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]