SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344210598|ref|YP_004794918.1| from Haloarcula hispanica ATCC 33960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344210598|ref|YP_004794918.1|
Domain Number 1 Region: 29-340
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.52e-108
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000306
Further Details:      
 
Domain Number 2 Region: 425-602
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.94e-52
Family NAD+-dependent DNA ligase, domain 3 0.0000485
Further Details:      
 
Domain Number 3 Region: 343-418
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00056
Further Details:      
 
Domain Number 4 Region: 612-689
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000043
Family DNA ligase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344210598|ref|YP_004794918.1|
Sequence length 694
Comment DNA ligase [Haloarcula hispanica ATCC 33960]
Sequence
MAVADDADLADNPYVEGPPTEFEDTTTLDEATAREQADQLREALRYHDYRYYVENDPVIG
DRAYDALFARLQRLESAFDLDTDGSPTQRVGGEPLDELPDVEHVARMGSIDQGGEEADVR
EFDERVRDGLGTDAVQYFCEPKFDGLSIEIVYEDGVYQRAATRGDGEVGEDVTENVRTIS
SVPQRLRGDYPDFLAVRGEVYIPRDAFTAFNRERVERGEDPFANPRNAAAGTLRQLDPAV
TAERPLSVFFFGVLDASVSFESHSEIHERFPEWGLRVCQRTAVVDDIDATIDYRTDQQQA
RDDLDYEIDGVVIKVDDMDACDELGSTSRAPRWAFAYKFPARKEETTVRDIVVQVGRTGR
LTPVALMDPVEVGGVTVSRASLHNPSLIADLGVDVGDRVRIKRAGDVIPDVVEVLDDNGD
GHFEFPDTCPACDSPVERDGPMAFCTGGLTCPAQRERSVEHYASRDALDIEGLGEKAVQQ
LLDADLVSDPADLYELTVEDLTDLEGWGETSARNLVEGMEDAREPPLANFLVALGIPEVG
TVTARNLAQEFGTFEAILDAADEGNTDAFEAVPDVGSTVTRSIVEFFEGEGNRAVIDRLL
DHVDPQAAEEMGGDALNGQTFVFTGSLDGYTRSDAQDLIERNGGSATSSVSGNTDYLVLG
DNPGQRKQDDADEYGVETLSEGEFEELLDDAGVL
Download sequence
Identical sequences G0HSA4 V5TI18
gi|564288612|ref|YP_008874821.1| WP_014039304.1.67629 WP_014039304.1.92404 gi|344210598|ref|YP_004794918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]